<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3147 3147-30409 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54T, V82A, L90M L33F L10I, E34Q, R41K, K55R, R57K, I62V, L63P, A71L, I93L  
>3147-30409| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFQEMNLPGKWKPKLIMGIGGFTRVKQYD
QVPIEICGHKLIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K32R, V35R, T39A, K43E, I135V, I142V, K166KR, G196E, T200A, V245E, T286A, I293V, P294T, E297R, A355G, A371T, K390R, E399D, A400S  
>3147-30409| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALREICAELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVTLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYGRMRGA
HTNDVKQLTETVQKIATESIVIWGKTPKFRLPIQKETWDS

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006