<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3141 3141-30422 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V, I84V, L90M L89V L10I, T12P, I13V, L19LP, K20M, E34Q, M36I, I62V, L63P, C67CY, A71T, P79AS, T91S, Q92R  
>3141-30422| codons 1-99
PQITLWQRPIVPVKIGGQPMEALLDTGADDTVLQEINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEIYGHKTIGTVVVGSTPVNVIGRNVMSRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75T, L210W, T215Y   K101E, Y181C, G190A V108VI V35VI, T39A, K43E, K102Q, V106VI, V118I, K122E, I142V, D177E, T200A, E203V, Q207E, H208Y, K223KE, L228H, V245Q, A272P, A288S, I293V, E297K, M357T, R358K, T386I, K390R E40FY
>3141-30422| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAYLEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLEQKKSITILDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRAKIVELREYLWRWGFYTPDKKHQEEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006