<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3128 3128-40708 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 64

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I47IV, I54V, V82L, L90M L23I, F53FL, Q58QE L10V, I13V, K20R, E35D, M36V, N37E, R57K, D60DE, I62V, L63P, A71IV, V77I, L89LM, I93L  
>3128-40708| codons 1-99
PQITLWQRPVVTVKIGGQLREAILDTGADDTVLEDVELPGRWKPKLVGGIGGLVKVKEYE
QVPIEICGHKVIGTVLIGPTPLNIIGRNMMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F, M184V, L210W, T215Y   Y181C, G190A K101H, V108I, Y318F V35I, T39A, V106I, V118I, K122E, D123DN, I135T, Q174K, R211K, A272P, I293V, Q334P, A355S, M357V, G359S, A376S, K390R  
>3128-40708| codons 2-399
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSITILDVGDAFFSIPLD
ENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPDIVIC
QYVDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAEL
ELAENREILKEPVHGVFYDPSKDLIAEIQKQGPGQWTYQIYQEPFKNLKTGKYSRVRSAH
TNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006