<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3122 3122-30526 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90LM L10F, L33I, K43T, N88D, L89V I13V, E35D, M36I, R41K, K55R, R57RK, D60E, I62V, L63P, A71T  
>3122-30526| codons 1-99
PQITLWQRPFVTVKIGGQLKEALLDTGADDTVIEDINLPGKWTPKIIGGIGGFVRVKQYE
QVPIEICGHKTIGTVLVGPTPANIIGRDVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N   K20R, K49R, V118I, K122E, I142V, R211K, L228H, L283I, I293V, E297K, I329V, Q334E, R356RK, G359S, A371V, V381I, K390R, E399D  
>3122-30526| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEVVQKIATESIIIWGKTPKFRLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006