<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3112 3112-30325 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
V75M, M184V   K103N V108I T69A, D123E, I135T, S162N, R211G, F214L, V245M, S251H, V292I, I293V, S322A, G335D, A360T, K366R, A376S, T386I  
>3112-30325| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSAKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLGWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDHWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVRQLTEAVQKISTESIVIWGKIPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, I84V L10F T12P, K14R, E34K, N37D, L63P, H69Y, A71T  
>3112-30325| codons 1-99
PQITLWQRPFVPIRIGGQLKEALLDTGADDTVLKEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKTIGTVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006