<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3112 3112-30325 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V V75M K103N V108I T69A, D123E, I135T, S162N, R211G, F214L, V245M, S251H, V292I, I293V, S322A, G335D, A360T, K366R, A376S, T386I, A400T  
>3112-30325| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSAKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLGWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDHWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVRQLTEAVQKISTESIVIWGKIPKFKLPIQKETWET

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, I84V L10F T12P, K14R, E34K, N37D, L63P, H69Y, A71T  
>3112-30325| codons 1-99
PQITLWQRPFVPIRIGGQLKEALLDTGADDTVLKEMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGYKTIGTVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006