<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3110 3110-30709 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10FI, L24I, L33F K20R, E35D, M36I, N37ND, R41K, K55KR, R57K, I62V, L63P  
>3110-30709| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVFEDIDLPGKWKPKLIGGIGGFVRVKQYD
QVPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       T39A, V118I, K122E, I142T, T200R, Q207E, V245K, I257L, K277R, T286A, I293V, P294Q, I329V, M357I, R358K, T377R, E399D  
>3110-30709| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRRKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVQLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARIKGA
HTNDVKQLTEAVQKIARESIVIWGKTPKFKLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006