<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3102 3102-30320 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54M, I84V L33F, G73T L10IV, K20R, E34EV, E35D, M36L, N37D, D60E, I62V, L63P, I72L, V77I, I93L  
>3102-30320| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVFVDLDLPGRWKPKIIGGIGGFMKVRQYE
QVPIEICGHKALTTVLIGPTPVNVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VA, L74V, L210W, T215Y A62V K101E, Y181C, G190A A98G V35VI, R83K, Q174R, T200A, E203D, L228R, I293V, E297K, S322T, I329L, F346FY, R356K, K366R, A376T  
>3102-30320| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDSSKWRKVVDFRELNKKTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
CQYMDDLYVASDLEIGQHRAKIDELRQHLWRWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPYKNLKTGKYAKMRGA
HTNDVRQLTEAVQKITTESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006