<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3094 3094-30331 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M L33F, G73S L10I, L24M, E35D, M36I, I62V, L63P, C67F, H69Q, K70E, A71IV  
>3094-30331| codons 1-99
PQITLWQRPIVTIKIGGQLKEALMDTGADDTVFEDINLPGRWKPKMIGGIGGFIKVRQYD
QVPIEIFGQEVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, Y115F, M184V   L100I, K103N P225H V35L, K102Q, K122E, T200A, H221Y, V245E, T286A, K311KR, D324E, I329L, Y354YH, S379C, K390R  
>3094-30331| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKQNKSVTVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKYQKEHPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILREPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKHARMRGA
HTNDVKQLTEAVQKIATECIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006