<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3090 3090-30925 France 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74I, M184V, L210W, T215F K219Q K103N, Y181C A98G, V108I V35T, T39A, K49R, V60I, V90I, K122E, I135V, E169K, K173T, Q174K, D177E, I178M, T200A, E203D, Q207E, D218E, L228H, V245Q, E248D, D250E, L283I, A288T, E291D, V292I, I293V, P294T, S322T, G335D, M357Q, G359S, A371V, I375V, A376S, K390R, K395R S162E
>3090-30925| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKEGKISRIGPENPYNTPI
FAIKKKNSDRWRKIVDFRELNKRTQDFWEIQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQESMTKILKPFRTKNPEMVI
CQYVDDLYVGSDLEIGQHRAKIDELREHLWRWGFFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKTLTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYARQRSA
HTNDVKQLTEVVQKVSTESIVIWGKTPKFRLPIQRETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82C, I84V V11I, L33I, K43T, F53FL L10I, T12M, I13V, K14R, L19P, K20I, A22V, M36I, R41K, K55R, H69K, K70R, I72V, T74S, L89I, T91S  
>3090-30925| codons 1-99
PQITLWQRPIIMVRIGGQPIEVLLDTGADDTVIEEINLPGKWTPKIVGGIGGLVRVRQYD
QILIEICGKRAVGSVLVGPTPCNVIGRNILSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006