<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3086 3086-30331 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I L10I, T12E, N37D, D60E, L63P, A71T, V77I  
>3086-30331| codons 1-99
PQITLWQRPIVEIKIGGQLKEALIDTGADDTVLEEMDLPGRWKPKIIGGIGGFVKVRQYE
QIPIEICGHKTIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y       K20R, V35I, K43KQ, E44ED, I135T, S162CY, Q207E, R211K, V245K, A272P, R284K, E297R, I329L, T338S, M357I, R358K, G359S, K390R, K395R, E399D  
>3086-30331| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWSYQIYQEPFKNLKTGKYARIKSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQRETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006