<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3084 3084-30520 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A L33F, F53L L10IV, I13V, G16E, N37D, I62V, L63T, A71I, V77I, I93L  
>3084-30520| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVFEEMDLPGRWKPKLIVGIGGLSKVRQYD
QVTIEICGHKIIGTVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70E, M184V, L210W, T215Y       K20R, E36K, K43E, K49R, D123E, E169D, D177E, L228N, A272P, L283I, E297EA, Q334R, G335D, G359S, A371V, I375V, T377Q  
>3084-30520| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVKICTELEEEGKISRIGPENPYNTPV
FAIKKKNSTEWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFNWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGTKALTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGRDQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKVAQESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006