<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3081 3081-30311 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54S, V82A, L90M L33F, Q58E L10IV, I13V, E34Q, R41RK, I62V, L63PS, K70T, A71V, V77VI, I93L  
>3081-30311| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVFQEMNLPGKWKPKLIVGIGGFSKVREYD
QVSIEICGHTVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SG, M184MV, T215Y V75VA   V108VI K64R, V118VI, D123E, I135T, I142V, S162C, G196E, R211A, L228LH, A288S, D324E, Q334R, M357T, R358K, T386I, E399D  
>3081-30311| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKDSSKWRKLADFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLAWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGRGQWTYQIYQEPFKNLKTGKYARTKGA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006