<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3076 3076-30318 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V L10F, L24I, L33F, K43T Q61H, L63P, A71I, I72T, V77I, T91TA, Q92K  
>3076-30318| codons 1-99
PQITLWQRPFVTIKIGGQLKEALIDTGADDTVFEEMNLPGRWTPKLIGGIGGFVKVRQYD
HIPIEICGHKITGTVLIGPTPANVIGRNLLAKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R     K20R, V35M, K43N, E44D, V118I, K122E, H208Y, R211K, D218E, V245E, E248Q, A272P, K277R, T286TA, I293V, V317A, I326V, Q334E, F346Y, G359GS, V365I, E370D, A371V, I375V, T377L, K390R, K395R, A400S  
>3076-30318| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPERKHQKEPPFLWMGYELHPDKWT
VQPIELPQKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLVAEIQKQGEGQWTYQIYQEPYKNLKTGKYARMRSA
HTNDIKQLTDVVQKVALESIVIWGKTPKFRLPIQRETWES

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006