<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3072 3072-30326 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, L90M L23I, Q58E L10I, I15V, K20R, M36I, N37D, I62V, L63P G52GV
>3072-30326| codons 1-99
PQITLWQRPIVTIKVGGQLREAILDTGADDTVLEEIDLPGRWKPKMIVGIGVFVKVREYD
QVPIEICGHKAIGTVLVGPTPSNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, K70R, M184V, T215F K219Q     P4S, K20R, V118I, I135T, F214L, K223KQ, L228H, T240TK, V245E, A272P, V276I, L283I, T286TP, I293V, P294T, R356RK, M357T, G359GS, A376V, T386M, K395KR G18GS
>3072-30326| codons 1-400
PISSIETVPVKLKPGMDSPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWK
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLIRGPKALTEVVTLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKTRSA
HTNDVKQLTEAVQKIVTESIVIWGKMPKFKLPIQRETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006