<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3065 3065-30519 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A L24I, L33F L10I, T12P, K14R, N37D, F53FY, I62V, L63P, G68D, A71T, I72V, V77I  
>3065-30519| codons 1-99
PQITLWQRPIVPIRIGGQLKEALIDTGADDTVFEEMDLPGRWKPKLIVGIGGYVKVRQYD
QVPIEICDHKTVGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K101P, K103KN   K43N, A98S, V118I, K122E, I135T, Q207E, R211K, V245M, A272P, I293V, D324E, Q334N, P345Q, G359GS, S379SC, K390R, E399D  
>3065-30519| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLPKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGNGQWTYQIYQEQFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATECIVIWGKTPKFRLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006