<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3056 3056-30318 France 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K101KE   K32R, V35T, T39K, K43E, V60I, V118I, D121Y, K122E, I135IV, E138A, S162A, D177E, I178M, E204EK, Q207E, V241I, V245Q, D250E, A272P, K277R, T286A, G333E, R358K, G359S, A371V, T377Q, S379C, K390R  
>3056-30318| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIRALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEKLREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
IQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLTEVVQKIAQECIVIWGKTPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82T L10F, L89V I13V, K20M, M36I, R41K, I62V, L63P, A71V, I72V, I93L  
>3056-30318| codons 1-99
PQITLWQRPFVTVKIGGQLMEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVRQYD
QVPIEICGHKVVGTVVVGPTPTNIIGRNVLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006