<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3055 3055-40212 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, L90M L89V L10I, T12A, I13V, K20T, L33V, M36I, R41K, L63P, A71T R8Q
>3055-40212| codons 1-99
PQITLWQQPIVAVKIGGQLTEALLDTGADDTIVEEINLPGKWKPKIVGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y K219R K103N A98G, V108I K20R, V35I, K43E, E44D, W88C, V118I, D123E, I135M, D177E, G196E, E203K, Q207E, H208Y, R211K, K223Q, V245E, I293V, E297K, V317A, I329V, G359S, T386I, Q394T N54I
>3055-40212| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEEDGKISKIGPEIPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFCEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIKELREYLWKWGFYTPDRKHQQEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPITKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006