<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3041 3041-40503 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210W, T215Y K219E G190A   V118I, K122E, E203K, R211K, K223KE, L228LH, A272AP, K277R, T286A, P294T, Q334D, A355AT, M357T, G359GS, A376S, T386I, K390R  
>3041-40503| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIKELRQHLWKWGFYTPDEKHQEEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVITLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDGQWTYQIYQEPFKNLKTGKYTRTRSA
HTNDVKQLTEAVQKISTESIVIWGKIPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84V   L10I, I15V, E34ED, E35D, M36I, N37S, L63P, A71V, T74S, I93L  
>3041-40503| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLDDISLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHKVIGSVLVGPTPTNVIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006