<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3038 3038-30304 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210*W, T215F V75M, K219Q K103S, G190A   K20R, K43N, V60I, K122E, I135M, A158AS, S162Y, T200TA, E203D, L228H, A272P, I293V, S322T, D324E, G335S, G359S, A371V, I375V, A376S, T377I, S379C  
>3038-30304| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPSIFQYSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIGQHRAKIDELRQHLWRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKELIAEIQKQGQSQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKVSIECIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47V, I54M, I84IV, L90M L10F, L33I, K43KT, N88ND K20I, E35D, M36I, N37D, L63P, A71T, I85V  
>3038-30304| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTIIEDIDLPGRWTPKIVGGIGGFMKVRQYD
QIPIEICGHKTIGTVLVGPTPVNVVGRDLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006