<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3037 3037-30307 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, L76V, V82F L23LIM, K43KT, G48GE, F53L L10I, I15V, G16E, L19LQ, K20M, N37D, D60E, A71V, I72R, I93L  
>3037-30307| codons 1-99
PQITLWQRPIVTIKVEGQQMEAMLDTGADDTVLEEMDLPGRWTPKIVEGIGGLVKVRQYE
QILIEICGHKVRGTVVVGPTPFNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, M184I, L210W, T215Y A62V Y188L A98G, V179E V35I, K64R, D123E, I135T, E138G, S162C, T200A, L228H, V245E, A272P, K277R, E297K, A376S, T377M, K390R  
>3037-30307| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIRKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNGTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIEI
YQYIDDLLVGSDLEIGQHRAKIEELRQHLWRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKISMESIVIWGKTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006