<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3036 3036-30310 France 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184I K219H Y181C, G190A A98G, V108I V35T, E36A, T39K, V60I, V90I, K101R, K122E, D123S, S162A, S163T, T165I, Q174E, D177E, T200A, Q207K, D218E, V245Q, K275KQ, K277R, T286A, E291D, I293V, P294T, E297EK, E300EQ, S322T, G335D, R356K, M357K, G359S, A360I, A371V, I375V, K390R, K395R K46M, E203N, L210I
>3036-30310| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEMEKEGMISKIGPENPYNTPI
FAIKKKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPGGLRKKKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQATMIKILEPFRKENPEIVI
CQYIDDLYVASDLEIGQHRAKINELRKHLIRWGFTTPEHKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVRQLCKLLRGAKALTDVVTLTKEAQ
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSI
HTNDVKQLTEVVQKVATESIVIWGKTPKFRLPIQRETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M L33I, L89V L10I, T12A, I13A, L19P, K20V, A22V, M36I, R41K, I66F, H69K, K70R, A71V, Q92K  
>3036-30310| codons 1-99
PQITLWQRPIVAAKIGGQPVEVLLDTGADDTVIEEINLPGKWKPKLIGGIGGFVKVRQYD
QILIEFCGKRVIGTVLVGPTPVNVIGRNVMTKIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006