<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3034 3034-30512 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74IV, M184MV, L210W, T215Y K219KN K101KE, K103KN, Y181C, G190A A98AG, V108VI E6K, V35L, K43E, E44A, V118I, K122E, I135T, T139R, S162Y, H208HY, R211K, K223Q, V245M, K277R, A288S, I293V, E297K, I326V, I329V, Q334D, M357K, A371V, I382V  
>3034-30512| codons 1-400
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLEKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNERPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
CQYVDDLYVASDLEIGQHRTKIEELRQYLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLVAEVQKQGDGQWTYQIYQEPFKNLKTGKYARKRGA
HTNDVKQLTEVVQKIATESIVVWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54LV, V82A, I84V, L90M L33F, G73GS L10I, I13V, K14KR, K20T, E35DN, M36I, R41K, I62V, L63P, A71V, I72V, I93L, C95F  
>3034-30512| codons 1-99
PQITLWQRPIVTVRIGGQLTEALLDTGADDTVFENINLPGKWKPKLIGGIGGFVKVRQYD
QVPIEICGHKVVSTVLVGPTPANVIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006