<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3033 3033-30227 France 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48Q, I50V, I54A, V82M K43T, F53L L10I, I13V, G16E, L19R, K20I, E35D, M36I, R41K, Q61D, L63C, I66F, H69K, L89M  
>3033-30227| codons 1-99
PQITLWQRPIVTVKIEGQRIEALLDTGADDTVLEDINLPGKWTPKMIQGVGGLAKVRQYD
DICIEFCGKKAIGTVLVGPTPMNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215F   L100I, K103N   V21I, V35T, T39K, K43A, V60I, K173L, Q174K, D177E, T200A, Q207A, R211K, V245Q, L283I, E291D, I293V, E312N, I329V, G335D, F346Y, R356K, M357R, R358G, G359S, T369V, A371V, K390R, E396D  
>3033-30227| codons 1-399
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALTEICKELEAEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTDVVPLTEEAE
LELAENREILKNPVHGVYYDPSKDLIAEVQKQGQDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLVEVVQKIATESIVIWGKTPKFRLPIQKDTWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006