<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3024 3024-40430 France 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, L210W, T215Y F77L, K219N K101P, K103N   E6D, T39A, K43E, E44A, V106I, V118I, K122E, K223Q, L228H, Q242H, K277R, T286A, I293V, V317A, M357T, K395R, E399D K390GR
>3024-40430| codons 1-399
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLPKNKSITVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTPDNKHQQEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQRETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54M, I84V, L90M G73A, L89V L10I, I13A, Q18H, K20I, E35EG, M36I, N37D, L63P, I64V, I66F, A71T, I72IL  
>3024-40430| codons 1-99
PQITLWQRPIVTAKIGGHLIEALLDTGADDTVLEGIDLPGRWKPKIVGGIGGFMKVRQYD
QIPVEFCGHKTLATVLVGPTPVNVIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006