<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3017 3017-30530 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, V82A, L90M L33F L10I, V11F, I13V, L19T, K20R, E35D, M36I, N37D, R57K, L63P, A71V, I93L  
>3017-30530| codons 1-99
PQITLWQRPIFTVKIGGQTREALLDTGADDTVFEDIDLPGRWKPKIIGGVGGFIKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K103N, Y181C   K20R, K122E, I135V, E138Q, S162C, T200A, L228H, L283I, I293V, S322A, D324DE, G359S, A371V  
>3017-30530| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNQTPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLIRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPAKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006