<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-3008 3008-30227 France 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, F53L, G73C L10V, I13V, G16A, K20R, M36I, L63P, A71V  
>3008-30227| codons 1-99
PQITLWQRPVVTVKIAGQLREALLDTGADDTIFEEINLPGRWTPKIVGGIGGLMKVRQYD
QIPIEICGHKVICTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67N, M184V, L210W, T215Y K219N, N348I Y188L   K22R, V35T, K43KE, E44EA, V106I, V118I, K122P, I135T, V179VI, V189VI, T200R, L205F, H208Y, R211K, K223Q, V245K, D250E, A272P, T286A, I293V, K311R, G335GD, M357T, K390R, Q394L  
>3008-30227| codons 1-399
PISPIETVPVKLKPGMDGPKVRQWPLTEEKIKALTEICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSIPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLLIGSDLEIGQHRRKIEEFRQYLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVVPLTEEAE
LELAENREILREPVHGVYYDPSKDLIAEIQKQGQDQWTYQIYQEPFKILKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPILKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006