<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2611 2611-30513 Switzerland 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54A, V82F, L90M L33I L10I, K14R, E35D, M36I, N37D, R41K, L63P, H69HY, A71V, I93L  
>2611-30513| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVIEDIDLPGKWKPKIIGGIGGFAKVRQYD
QIPIEICGYKVIGTVLVGPTPFNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210LW, T215Y       T7P, V21I, K43Q, K102KR, D123N, K166KQ, D177E, H208HY, R211K, A272P, T286A, E297K, Q334D, A371V, K390R, E399D  
>2611-30513| codons 1-399
PISPIEPVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTQILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGDGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFRLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006