<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2606 2606-30623 Switzerland 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47A, L90M   L10I, R41K, I62V, L63P, I64V, I85V, I93L  
>2606-30623| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMNLPGKWKPKIAGGIGGFIKVRQYD
QVPVEICGHKAIGTVLVGPTPVNIVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y   G190A   K20R, V118I, I135T, I178M, V179VI, I195L, G196E, R211K, A272P, E297K, S322A, Q334E, R358K, G359S, A371V, A376S, T386I, E399D  
>2606-30623| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMII
YQYVDDLYVASDLELEQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGEGQWTYQIYQEPFKNLKTGKYARMKSA
HTNDVKQLTEVVQKISTESIVIWGKIPKFKLPIQKETWDA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006