<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2605 2605-30317 Switzerland 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I50V, I54T, V82A L33I L10IV, K20R, M36I, N37S, I62V, L63P, I64V, H69R, A71V, I85V  
>2605-30317| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVIEEISLPGRWKPKLIVGVGGFTKVRQYD
QVPVEICGRKVIGTVLVGPTPANIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E L100I, K103N   K20R, V90I, D123E, I135T, S162Y, K166R, Q207E, R211K, L228H, A272P, E297K, P321S, D324E, Q334N, G359S, T386I  
>2605-30317| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDSSKELIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARMRSA
HTNDVKQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006