<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2405 2405-30826 Sweden 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y   K103N, Y181YC A98G, V108I, Y318YF K20KR, V35T, E36A, T39D, S48E, I135T, K173A, Q174K, D177E, I195L, G196T, T200A, Q207E, R211K, L228H, V245Q, E291D, I293V, P294Q, Q334H, G335D, K350KR, G359T, T377M, T386IV, K390R  
>2405-30826| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTAICDELEKEGKIEKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
CQYVDDLYVGSDLELTQHRAKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTDVVQLTEEAE
LELAENREILKEPVHGVFYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLRTGKYARMRTA
HTNDVKQLTEAVQKIAMESIVIWGKVPKFRLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82A L10F, K43T, T74P T12S, I15V, L19T, K20R, M36I, Q61E, I62V, L63P, H69K, L89M, I93L  
>2405-30826| codons 1-99
PQITLWQRPFVSIKVGGQTREALLDTGADDTVLEEINLPGRWTPKIIGGIGGFIKVRQYD
EVPIEICGKKAIGPVLVGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006