<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2254 2254-30930 Portugal 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82S, L90M L33F, Q58E L10V, I13IV, I15V, L19I, K20R, E35D, M36I, N37D, R41K, K55R, R57RK, I62V, L63P, H69K, A71T, T74S, I85V, L89I, I93L, C95F, T96TS  
>2254-30930| codons 1-99
PQITLWQRPVVTVKVGGQIREALLDTGADDTVFEDIDLPGKWKPKMIVGIGGFVRVKEYD
QVPIEICGKKTIGSVLVGPTPSNIVGRNIMTQLGFSLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219W K101E, Y181C A98G, V108I V8VI, K20R, E28K, K32E, V35K, T39E, V118I, K122E, D123S, I135T, E138A, K173A, D177G, V179I, T200A, E203K, L205F, Q207D, H208Y, L210S, R211K, D218E, K223Q, L228H, Q242K, V245Q, K275Q, T286A, E291D, V292I, I293V, Q334E, G335D, R356K, M357R, G359T, T377L, K385R, K390R  
>2254-30930| codons 1-399
PISPIETIPVKLKPGMDGPRVKQWPLTKEKIEALKEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTILDVGDAYFSIPL
DESFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPGIII
CQYVDDLYVGSDLEIGQHRAKIKEFRDYLSKWGFFTPEWKHQQEPPFHWMGYELHPDKWT
VKPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIQVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGEDQWTYQIYQEPFKNLKTGKYAKRRTA
HTNDVKQLTEAVQKIALESIVIWGRTPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006