<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2245 2245-30722 Portugal 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A, L90M L33F L10I, I13V, K20V, E35D, M36V, N37C, L63P, I64V, A71V, V77I, I93L, C95CF  
>2245-30722| codons 1-99
PQITLWQRPIVTVKIGGQLVEALLDTGADDTVFEDVCLPGRWKPKIIGGVGGFVKVRQYD
QIPVEICGHKVIGTVLIGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N   K20R, V35R, K122E, D123N, I135T, E203K, Q207S, R211K, T286A, E297K, V317A, D324E, I326V, A371V, A376ST, T377L  
>2245-30722| codons 1-400
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELRSHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGAYYDPSKELVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEVVQKITLESIVIWGKTPKFKLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006