<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2212 2212-30624 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R D67G, T215I, K219Q K103N   K20R, V35T, V60I, A98S, K122E, D123S, I135L, S162A, K173R, Q174K, N175Y, D177E, T200A, Q207E, H208Y, R211K, L228H, V245Q, E248D, D250E, A272P, L283LI, T286A, A288T, E291D, V292I, I293V, E297A, D324E, I329V, Q334L, G335D, F346Y, R356K, M357R, R358G, G359S, A371V, T386I, K390R, Q394R, E399D  
>2212-30624| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKGSDRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRRKYPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREYLLKWGFITPDQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLIRGAKTLTDIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQGLDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKIPKFRLPIRKETWD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VFI, L90M L23LI, F53FL, L89MV L10LI, I13AV, K14R, K20I, E35G, M36I, R41K, D60E, L63P, H69KR, A71V, T74S, I93L  
>2212-30624| codons 1-99
PQITLWQRPIVTVRIGGQLIEAILDTGADDTVLEGINLPGKWKPKMIGGIGGLVKVRQYE
QIPIEICGRKVIGSVLVGPTPINIIGRNVMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006