<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2201 2201-30331 Portugal 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, I84V, L90M L33F, G73A L10I, V11L, I13V, N37H, R41K, K45R, L63P, A71V, V77I, I93L  
>2201-30331| codons 1-99
PQITLWQRPILTVKIGGQLKEALLDTGADDTVFEEMHLPGKWKPRMIGGIGGFLKVRQYD
QIPIEICGHKVIATVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VG, L210W, T215Y D67G, K70T G190A K101H V35I, E44D, A98S, K122E, I135T, G196E, D250E, A272P, K277R, I293V, S322T, Q334N, R358K, A376T, T386M, K390R S68A, L92M
>2201-30331| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKDGKISKIGPENPYNTPV
FAIKKKGASTWRKLVDFRELNKRTQDFWEVQMGIPHPSGLHKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVASDLEIEQHRTKIEELRQHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGNGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKITTESIVIWGKMPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006