<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-2026 2026-30429 Netherlands 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E K14KR, E35D, M36I, D60E, Q61E, I62V, L63E, I64V, E65D, K70R, I72IV  
>2026-30429| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVREYE
EVEVDICGHRAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, I202IV, R211K, A272P, T286A, A288AS, I293IV, E297K, L310LI, E312D, I326V, Q334E, M357T, K366R, T369TA, E370ED, A371AV, K374KR, I375IV, A376T, T377L  
>2026-30429| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKSLTEVVPLTKEAE
LELAENREIIKDPVHGVYYDPSKDLVAEIQKQGEGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVRQLADVVQRVTLESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006