<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1436 1436-30319 Denmark 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   L10Y, K20I, M36V, L63P, I64V, I93L  
>1436-30319| codons 1-99
PQITLWQRPYVTIKIGGQLIEALLDTGADDTVLEEVNLPGRWKPKIIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KEGR, L74V, M184V K219Q L100I, K103N   T69N, T200TA, D218E, L228LR, A272P, V276VI, K277R, L283I, R284K, I293V, P294S, S322T, I329L, R356K, A376S, K390R  
>1436-30319| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPEQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKIRQLCKLIKGTKALTEVVSLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEAVQKISTESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006