<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1428 1428-30905 Denmark 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, L210LW, T215F V75M, K219Q K103N, G190A V108VI P4Q, E6K, V8VI, T39A, E44D, E53D, V60I, K102N, K122E, T139M, I142IV, S162Y, T200A, R211NS, D218DE, L228LR, R284K, A288S, E297K, K311R, D324E, I329L, R358K, V365VI  
>1428-30905| codons 1-399
PISQIKTIPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKDGKISKIGPDNPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKNNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRAKIEELRQHLWSWGFFTPEQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKSLTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDIKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50IV, I54V, V82S L10FI, L24I, L33LF, F53FL L19I, K20R, E35D, M36I, N37D, R41KN, K55R, R57K, I62IV, L63P, A71V, I72V, T74TS, L89LI  
>1428-30905| codons 1-99
PQITLWQRPIVTIKIGGQIREALIDTGADDTVFEDIDLPGNWKPKIIGGVGGLVRVKQYD
QVPIEICGHKVVGSVLVGPTPSNIIGRNILTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006