<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1424 1424-30312 Denmark 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M V11I, L33F, F53L, G73S L10I, I62V, L63P, C67F, A71I, I72E, V77I, I85V, T91A  
>1424-30312| codons 1-99
PQITLWQRPIITIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIVGGIGGLVKVRQYD
QVPIEIFGHKIESTVLIGPTPVNVVGRNLMAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, L210W, T215Y   L100I, K103N   K20R, K43N, V118I, K122E, D177H, T200A, F214FL, A272P, P294T, E297R, Q334P, G359S, A360AV, A371V  
>1424-30312| codons 1-399
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPHIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVITLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGPGQWTYQIYQEPFKNLKTGKYARMRSV
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006