<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1409 1409-30304 Denmark 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, T215Y K219E Y181C, G190S   E6EK, V35I, K101Q, V106I, K122E, V179I, Q207EK, V245T, K277R  
>1409-30304| codons 1-399
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVSSDLEIGQHRTKIEELRKHLLRWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33F, Q58E L10I, I13IV, K20R, E34EV, E35D, M36I, N37ND, I62V, L63P, I66V, A71T, I72V, I93L, C95F  
>1409-30304| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVFVDIDLPGRWKPKMIGGIGGFVKVREYD
QVPIEVCGHKTVGTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006