<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1405 1405-30227 Denmark 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48A, I54V, V82A L24I, Q58E L10I, K20R, E35D, M36I, R41K, G51A, F53Y, K55KR, R57RK, D60E, Q61E, L63P, A71V, I72V G17GR
>1405-30227| codons 1-99
PQITLWQRPIVTIKIGRQLREALIDTGADDTVLEDINLPGKWKPKIIAGIAGYVRVKEYE
EIPIEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, L210W, T215F K219Q, N348I K103N, Y181C V108VI T39TA, K43N, V60I, K122E, I135L, G196E, T200A, E203V, Q207E, D218E, L228R, A272AP, A288S, V317A, G359S, K366R, E399ED  
>1405-30227| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELENEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRAKIVELREHLWRWGFFTPEQKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKILKTGKYARMRSA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006