<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1273 1273-30904 Belgium 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, V82T, I84V K43T, F53L, L89V L10I, I13A, K14R, K20V, A22V, M36I, N37D, R41K, L63P, I66V, H69K, A71V, T74S T91TCS
>1273-30904| codons 1-98
PQITLWQRPIVTARIGGQLVEVLLDTGADDTVLEEIDLPGKWTPKIVGGIGGLVKVRQYD
QIPIEVCGKKVIGSVLVGPTPTNVIGRNVLSQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K103N F227L V35T, E42EK, K49KR, V60I, T69N, V90I, K122E, D123S, A158S, E169D, K173R, Q174K, D177E, I178M, G196E, T200A, E203A, Q207E, H208Y, R211K, D218E, L228LH, V245Q, E248D, D250E, A272P, T286A, V292I, I293V, E297A, D324E, I329V, Q334P, G335D, F346Y, R356K, M357R, R358G, G359S, A371V, Q394R  
>1273-30904| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELKKEGKISRIGPENPYNTPI
FAIKKKNSNRWRKIVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRRKNPEMVI
YQYVDDLYVGSDLEIEQHRAKIAELREYLLKWGFFTPEQKHQKEPPLHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEVQKQGPDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIRKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006