<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1258 1258-30610 Belgium 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54V, V82A, L90M F53L L10I, K20KR, M36MI, I62V, L63P, I64V, H69HY, A71AT, T74S, V77VI, I85V T91TCS
>1258-30610| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEEINLPGRWKPKMIMGIGGLVKVRQYD
QVPVEICGYKTIGSVLIGPTPANIVGRNLMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69G_SG, M184I, L210W, T215Y A62V K101E, Y181C, G190A A98G V35VI, K43E, K49R, K122E, R211RK, A272P, R356K, K366R, T386I  
>1258-30610| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEEEGKISRIGPENPYNTPV
FVIKKKDSGKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLEKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYIDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVRQLTEAVQKIATESIVIWGKIPKFKLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006