<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1250 1250-31215 Belgium 2003 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 29

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90LM   L10I, E35D, M36I, R41K, Q61HN, I62V, L63R, K70E L89LW
>1250-31215| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NVRIEICGHEAIGTVLVGPTPVNIIGRNWMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69TADN T215C, K219Q K103N   P4T, V35T, V60I, K104KN, V118I, D121H, K122E, I135T, Q174R, D177E, I178L, Q207E, R211K, F214L, V245T, D250E, A272P, T286A, A288T, E297A, I329L, G335D, R356K, G359NS, V365I, A376S, T386I, K390R  
>1250-31215| codons 1-400
PISTIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNNSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLCTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTEVIPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQDQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDIKQLTEAVQKISTESIVIWGKIPKFRLPIQKETWEA

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006