<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1244 1244-30527 Belgium 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75T, L210W, T215Y K219D Y181C, G190A A98G, V179E T27S, E28K, K32E, V35T, E36D, T39N, V60I, K64KR, K102Q, V118I, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, E203K, Q207E, H208Y, R211K, K223E, L228H, Q242H, V245Q, D250E, K281R, T286A, E291D, V292I, I293V, P294T, S322A, G335D, R356K, M357K, G359S, A360AT, A371V, I375V, T386I, K390R, K395R  
>1244-30527| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLSKEKIEALTDICNELEKEGKISKIGPENPYNTPI
FAIRKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHPGGLKQKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEMEI
CQYMDDLYVASDLEIGQHRAKIKELREYLWKWGFYTPDDKHQEEPPFHWMGYELHPDKWT
VHPIQLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRST
HTNDVKQLTEVVQKVATESIVIWGKIPKFRLPIQRETWE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, I84V V11VI, L33F, K43T, F53L T4A, L10V, I13V, G16A, L19P, K20M, E35D, M36L, K55R, Q61H, L63P, H69K, T74AS, L89I, T91S E21A
>1244-30527| codons 1-99
PQIALWQRPVITVKIAGQPMAALLDTGADDTVFEDLNLPGRWTPKLIGGIGGLVRVRQYD
HIPIEICGKKAIGSVLVGPTPANVIGRNILSQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006