<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1243 1243-30527 Belgium 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48A, I54V, V82A, I84V V11I, L24I L10I, T12TP, I13IV, K14KR, A22V, E35ED, M36MI, R57K, D60E, Q61D, I62V, L63P, A71I, T91A  
>1243-30527| codons 1-99
PQITLWQRPIIPVRIGGQLKEVLIDTGADDTVLEDINLPGRWKPKMIAGIGGFVKVKQYE
DVPIEICGHKIIGTVLVGPTPANVIGRNLLAQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, M184V, L210W, T215F K219W K103N   V35I, T39A, K43E, V118I, K122E, I135T, S162C, G196E, E203D, Q207E, D218E, I293V, M357T, A400S  
>1243-30527| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIDELREHLWRWGFFTPEWKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWES

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006