<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1206 1206-30604 Luxembourg 2003 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I50V, I54V, V82A L24I, L33F, Q58E L10I, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, I62V, L63Q, H69Y, L89M  
>1206-30604| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVFEDINLPGKWKPKLIGGVGGFVKVKEYD
NVQIEICGYKAIGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y   K103N, Y181C   V35T, T39A, E44D, K49R, V60I, V90I, K122E, D123S, S162D, E169A, K173A, Q174K, I178L, Q207E, R211K, D237E, V245Q, E248D, A272P, T286A, A288T, E291D, V292I, I293V, E297A, F346Y, R356K, M357R, G359S, A376S, T377L, K390R, Q394L, E399D E312E*
>1206-30604| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISRIGPENPYNTPI
FAIKKKNSDKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILAPFRAKNPDLVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPEKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKTLTDIVPLTAEAE
LELAENREILK*PVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPYKNLKTGKYAKRRSA
HTNDVKQLTEAVQKISLESIVIWGKTPKFRLPILKETWD

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006