<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1835 1835-30929 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82ACGS, L90M L10F, L33F, G73S L19I, E35D, M36L, K43S, R57K, I62V, L63P, C67W, H69R, A71V, I72M, I93L  
>1835-30929| codons 4-99
TLWQRPFVTIKIGGQIKEALLDTGADDTVFEDLNLPGRWSPKMIGGIGGFVKVKQYDQVP
IEIWGRKVMSTVLVGPTPSNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L210L*W, T215Y K219Q K103N, Y181C   V60VI, K66KR, I142V, S162A, Q207N, R211K, D218E, L228H, Q242H D113N
>1835-30929| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKRNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGNAYFSVPLDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQASMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRNHLWKWGFYTP
EQKHQKEPPFHWMGYELHPDKWTVHPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006