<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1832 1832-30924 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VAFS, L90LM L33LI, K43T L10I, K20KR, E35D, M36I, N37S, D60DE, Q61E, I62IV, L63P, I64IV, I93L  
>1832-30924| codons 4-99
TLWQRPIVTIKIGGQLREALLDTGADDTVIEDISLPGRWTPKMIGGIGGFVKVRQYEEVP
VEICGHKAIGTVLVGPTPSNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N P225PH K43E, K122E, I142V, R211K I167IM
>1832-30924| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKMLEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTP
DKKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006