<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1816 1816-30929 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I47V, I54V, I84V, L90M L10F, V11I, Q58E, G73S I13V, L19Q, K20I, M36I, R41K, K55KR, L63P, H69R, A71I, I72IM, I93L  
>1816-30929| codons 4-99
TLWQRPFITVKIGGQQIEALLDTGADDTVLEEINLPGKWKPKIVGGIGGFVRVREYDQIP
IEICGRKIMSTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70R, Q151M, M184I A62V, V75I, F77L, F116Y K101E, Y181C, G190A   S68G, D123E, I142V, S162C, Q174QR, I178L, L228R, V245E  
>1816-30929| codons 38-246
CTEMEKEGKISKIGPENPYNTPVFVIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYYSVPLDKEFRKYTAFTIPSINNETPGVRYQYNVLPMGWKGSP
AIFQCSMTKILEPFRKRNPDLVICQYIDDLYVASDLEIGQHRTKIEELRQHLLRWGFTTP
DKKHQKEPPFRWMGYELHPDKWTVQPIEL

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006