<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
48-1861 1861-30925 Mexico 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, E35D, M36I, N37S, R57K, I62V, L63P, I64L, A71T, I72T, Q92K, I93L, C95CF  
>1861-30925| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEDISLPGRWKPKMIGGIGGFIKVKQYDQVP
LEICGHKTTGTVLVGPTPVNIIGRNLMTKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y   Y181C, G190A   K43E, E44A, V118I, K122E, D123E, I178M, L205F, Q207E, H208Y, R211K, K223Q  
>1861-30925| codons 38-247
CTELEEAGKISKIGPENPYNTPVFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVICQYMDDLYVASDLEIGQHRTKIEEFREYLWKWGFYTP
DKKHQQEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006